PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G309500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 622aa    MW: 68006.6 Da    PI: 6.4403
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G309500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28569619151
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                         aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik+
  Sevir.2G309500.2.p 569 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKK 619
                         5899*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.608557621IPR003035RWP-RK domain
PfamPF020425.1E-25572619IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MVFLAQDVHG GMEPCLSISS RGEVKCYPER VTCMEEGGGD PQPSFSLQAR TPSEGGAAVD  60
LDLLEQLLSG DNGWFDVVSR SPNSLASPPP AAFFSADVTA AAVTTTSSST QAASSWWIQT  120
GGASPSSVRD RFSQALSYIR ETQSDGDVLV QLWVPVSRGD GRLVLTTSGQ PFTLDQSSDS  180
LIRFREVSTK YQFSADVKSG DSPGLPGRVF IGRLPEWSPD VRYFTTYEYP RVRDAQYLDV  240
HGTMGLPVFE KGSYNCLGVI ELIMTRQKLN FTSELNTICS ALQAVNLRSA EVSSVPRVQF  300
STASYKNALP EILEVLRAAC LTHKLPLAQT WVTCAQQGKR GSRHSDENYP YCISTIDEAC  360
FVNEPEMQDF HDACSEHHLL RGQGVAGKAF TTNQPCFLPD IGSSAKLDYP LSHHAKIFKL  420
KGAVAIRLRC TRTGTADFVL EFFLPTDCQA LEEQKEVLDS LSGTMRSVCQ TLRVVTDKEM  480
EDEAMWETNE LNSFTPQGKN KAEELSFGGN SADRRGEASW TSLAETSQQE SELAALRMHG  540
MFSSGGQGPS LSGVQSAAEG SKAKRRTKAE KTVSLQVLRQ YFAGSLKDAA RSLGVCPTTL  600
KRICRQHGIT RWPSRKIKKE V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957562.10.0PREDICTED: protein NLP1 isoform X1
SwissprotQ9SFW81e-180NLP5_ARATH; Protein NLP5
TrEMBLK3ZQN50.0K3ZQN5_SETIT; Uncharacterized protein
STRINGSi028915m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.11e-180Nin-like family protein